SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Cucsa.363310.1|PACid:16981069 from Cucumis sativus v122

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Cucsa.363310.1|PACid:16981069
Domain Number 1 Region: 690-798
Classification Level Classification E-value
Superfamily BRCT domain 1.89e-20
Family 53BP1 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Cucsa.363310.1|PACid:16981069
Sequence length 922
Sequence
MKTRDAWPSVIIDKDKEKSSLKDSHVDRHNGLGQSSVNDGDSGNVKCRVGSSAVRKLFTD
DYTPVGDFGDLPTKLDASDVDLHQLTACDGDGDQLAGLSYVDSQEPGDLTQDNALDFVEK
FLKDNSMEFGLGVGMHKRNAMVQPKSVPNPRGQYNLASIVNCVRVVGESRVFDWDDNRED
EGGGDIFRRRKEEFLTEPRKSKGRKLDLSGDKEASMSNQNMKSRLFCSDSRLELRKGKGN
NEPSRESNIECKRNLSYKLDKENDGDPCRGELQNNGIQPDQLEEANVGFDTQMAAEAMEA
LFNDANIHELVYNETNQHLENGSTDSFRGSPSRKSYSSSKLRRSSRGHASSSEVAPMQSK
IRNQKFSGVITKACGDEIVKLSNRSKKRDADAINGNENIGYDLKNACNKVQKQQNACNKV
QKRLLRGKVVEVSPVACRTRHSIIVNQSKKAKIASSGCERSAAKVGSFIKKSSGDRGTRD
FEAKRTKSLEAASKTLKMKSKGAKNDAKRSIGERGLCDMLAGEASLPGDLLGQTMNRRKR
SCNVKKTRASLCLLSPPSNKNLKRPTVSRTGAEKAHGGTITADTNDQLSIEDSNRPNSVQ
QLNKKNDGCSVSSVVKTTPDESPSKRHKPSVTVCTSPSDNSMTPINSVSPVCMGSEYYKQ
SCKKNLSKSSLLKELRDLTSSGFVSRSCPTESRKRKDMTDVRVLYSQHLDEGIIKQQKKT
LTRLGVTVVSSMAEATHFIADKFVRTRNMLEAIALGKLVVTHLWIDSCGQASCFIDEKNH
ILRDTKKEKEVGFSMPGSLACARQRPLLEGRRVLITPNTKPGIAIISSLVKVVKGQAVER
IGRSMLKDDQIPDDLLVLSCEEDYNTCLPFLEKGAAVYSSELLLNGIVTQKLEFERHRIF
VDHVKRTRSTIWLKKDGNKFQP
Download sequence
Identical sequences Cucsa.363310.1|PACid:16981069

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]