SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Cucsa.385080.1|PACid:16982517 from Cucumis sativus v122

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Cucsa.385080.1|PACid:16982517
Domain Number 1 Region: 589-805
Classification Level Classification E-value
Superfamily ADP-ribosylation 3.45e-44
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.0000931
Further Details:      
 
Domain Number 2 Region: 451-586
Classification Level Classification E-value
Superfamily Domain of poly(ADP-ribose) polymerase 1.44e-29
Family Domain of poly(ADP-ribose) polymerase 0.0011
Further Details:      
 
Domain Number 3 Region: 300-429
Classification Level Classification E-value
Superfamily WGR domain-like 2.09e-23
Family WGR domain 0.00073
Further Details:      
 
Domain Number 4 Region: 187-276
Classification Level Classification E-value
Superfamily BRCT domain 0.00000000000000589
Family DNA ligase 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Cucsa.385080.1|PACid:16982517
Sequence length 814
Sequence
MVHETRSHSHTHGAGEEEKIMTRKQKAESKTHENEQSPKKIKSEDENGRANGKSEASDLT
KEFEEFCKATRESLSIDQMKEILQMNDQDSTGPDYEIASKCQDLLFYGALETCPVCRGRL
VFDGKRYVCNGFLSEWSTCTFKTKDPPRRNETNKLPESVLNSPVSDLIKKYQNPSQRPKR
NLGQSDKPFSGMTISLSGRLSRTHHYWRKEIEKHGGTVNNSVIGVSCLVVSPAERERGGS
SKVAEAVERGIRVIREAWLLDSIEKQEAQPLEAYDVVTDLAVEGKGIPWDKQDPSEEALE
SLTAELKLYGKRGVHKDTKLQEQGGEIFEKDGILYNCAFSLCDQGRGLNEYCITQLIKVP
DKNLHLFYKKGKVGDDPNAEERLEEWENEGNAVKEFVRLFKEITGNEFELWEREKKFEKK
RGSFHPIDMDDGVDVRHGGLGLRQLGIATVHSKLEPEIANFMKVLCSQEIYKYALMEMAH
DPPELPMGMLSKFHLERCEEILLEFIEKVKSMEETGFKAEAVWTDYSNRWFTLMHSTRPL
IFKDYQEIAEHAAAVLEGVRDVTVASHLIGDMSGSTIDDPLSDRYGKLGGSVSLLEKDSD
DYKMIVNYLEKTYEPVKVGDIEYGVTVDNIFSVESAALPSYGEIKKQPNKVLLWCGTRSS
NLLRHLHKGFLPAICSLPVPGYMFGRAIVCSDAAAEAARYGFTAVDRPEGFLVLAIVSLG
EEITEITSLPEDTKLLEERKMGVKALGRKKTDESEHFVWKDEIRVPCGPLITSEHKDSPL
EYNEYAVYNPKQTNIRFLVGVKYEEKGVVMDTQE
Download sequence
Identical sequences Cucsa.385080.1|PACid:16982517

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]