SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Cucsa.109200.1|PACid:16959808 from Cucumis sativus v122

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Cucsa.109200.1|PACid:16959808
Domain Number 1 Region: 47-258
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.19e-24
Family BAR domain 0.076
Further Details:      
 
Domain Number 2 Region: 270-363
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000142
Family SH3-domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Cucsa.109200.1|PACid:16959808
Sequence length 375
Sequence
MDAIRKQATKLREQVARQQQAVLKQFGAGGYGGSDNIITDEAELHQHQKLEKLYISTRAG
KHFQRDIVRGVEGYIVTGSKQVEIGTKLSEDSRKYGAENTCTSGSTLSKAALNYGRARAQ
MEKERGNMLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQEAEAQAIEVFKRQARV
REAPGNAEITVKLEAAEAKLHDLKSNMATMGKEAAAAMAAVEAQQQRLTLQRLIAMVEAE
RAYHQRVLQILDQLEGEMILERQRIEAPPTPPPGPSIDNSMPPPPSYEEVNGVFASQAHN
GSTDAMGYFLGEVMHPYLAESDVELNLSVGDYVVVRKVSNNGWAEGECKGKAGWFPFGYI
ERRERVLASKVAEVF
Download sequence
Identical sequences A0A0A0LPE3
Cucsa.109200.1|PACid:16959808 XP_004150141.1.97903

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]