SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Cucsa.142970.1|PACid:16963714 from Cucumis sativus v122

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Cucsa.142970.1|PACid:16963714
Domain Number 1 Region: 163-244
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000453
Family Eukaryotic type KH-domain (KH-domain type I) 0.0016
Further Details:      
 
Domain Number 2 Region: 274-304
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000000628
Family CCCH zinc finger 0.002
Further Details:      
 
Domain Number 3 Region: 98-130
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000000144
Family CCCH zinc finger 0.0024
Further Details:      
 
Domain Number 4 Region: 38-64
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000693
Family CCCH zinc finger 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Cucsa.142970.1|PACid:16963714
Sequence length 308
Sequence
MDLDGARKRERTETALNGNGGFKKSKPEMDSLSTGLGSKSRPCTKFFSTSGCPFGEGCHF
AHYVPGGVKSISQMISPALPPGIRNPAPPQSFPDGVPPAVKTRLCNKFNSAEGCRFGDKC
YYAHGEWELGRPNPPQDHGGMGPGPMQQPRMGGGWNAPPPPPNHGPAASFGASATAKISV
DASLAGPIIGKNGVNSKNICRMTGARLSIKEHESDPNLKNIELEGTFDQINLASSMVREL
IANVGAASANNAMKQHQQHQHHSGMQQSSGSANNFKTKLCANFTKGACTFRERCHFAHGE
SELRKPGM
Download sequence
Identical sequences A0A0A0M2L9
XP_004149023.1.97903 Cucsa.142970.1|PACid:16963714

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]