SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Cucsa.165100.1|PACid:16965961 from Cucumis sativus v122

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Cucsa.165100.1|PACid:16965961
Domain Number 1 Region: 563-750
Classification Level Classification E-value
Superfamily Sec7 domain 2.35e-70
Family Sec7 domain 0.0000076
Further Details:      
 
Domain Number 2 Region: 345-485,633-716,805-859,1030-1109,1160-1178,1244-1360
Classification Level Classification E-value
Superfamily ARM repeat 0.00000225
Family MIF4G domain-like 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Cucsa.165100.1|PACid:16965961
Sequence length 1469
Sequence
MGRLKLQTGINAIEEEPEECDVTYTNKTALACMINSEIGAVLAVMRRNVRWGGRYMSGDD
QLEHSLIQSLKSLRKQIYSWQHPWHTINPAVYLQPFLDVVRSDETGAPITGVALSSVYKI
LTLDMIDQNTVNAGDSVHLIVDAVTCCRFELTDPASEEMVLMKILQVLLACMKSKASIML
SNQHVCTIVNTCFRIVHQAATKGELLQRIARHTVHELVRCIFSHLSEINTTERALVNGNS
SSKQEAGRGANDDYVLGNRLLENGNVGHEFDGQSSSNNFDSNPSSGLMATGMEENLLEDG
SAKDTVPFDFHLMNEPYGVPCMVEIFRFLCSLLNLVEHMELGARSNTMAFDEDVPLFALG
LINSAIELGGPSFRHHPRLLSLIQDELFRNLMQFGLSTSSLILSMVCSIVLNLYHHLRTE
LKLQLEAFFSCVILRLAQSRYGASYQQQEVAMEALVDFCRQKTFMVEMYANLDCDITCSN
VFEDLANLLSKSAFPVNCPLSSMHILALDGLIAVIQGMAERIGNGAGLENTPVNLEEYTP
FWMVKCENYSDPTQWVPFVRRKKYIKRRLMIGADHFNRDPKKGLEFLQGTHLLPDKLDPK
SVACFFRYTAGLDKNLVGDFLGNHDEFCVQVLHEFAWTFDFQDMNLDTALRLFLETFRLP
GESQKIQRVLEAFSERYYEQSPQILVNKDAALLLSYSLIMLNTDQHNVQVKKKMTEEDFI
RNSRHINGGNDLPRDFLSELYHSICKNEIRTTPEQGNGFPEMTPSRWIDLMHKSKKSSPF
IVSDSKAYLDRDMFAIMSGPTIAAISVVFDHAEHEEVYQTCIDGFLAVAKISACHHLEDV
LDDLVVSLCKFTTLMNPSSVEEPVLAFGDDTKARMATMTVFTIANRYGDFIRTGWRNILD
CILRLHKLGLLPARVASDAADESELSADAGHGKPLTSSLSAAHIQSIGTPKRSSGLMGRF
SQLLSLDSEEPRSQPTEQQLAAHQRTLQTIQKCNIDSIFTESKFLQAESLLQLAQALIWA
AGRPQKGNSSPEDEDTAVFCLELLIAITLNNRDRIVLLWPGVYDHISNIVQSTVMPCALV
EKAVFGLLRICQRLLPYKENLADELLRSLQLVLKLDARVADAYCEQITQEVSRLVKANAS
HIRSPSGWRTITSLLSITARHPEASEAGFDALLFIVSDGAHLLPANYTLCIDASRQFAES
RVGQAERSLRALDLMAGSVDCLGRWAKEGKEAAREEEAIKMSQDIGDMWLRLVQGLRKIC
LDQREEVRNQALLSLQKCLTGVDEINLPHDLWLQCFDLVIFTMLDDLLEIAQGHSQKDYR
NMEGTLILAMKLLSKVFLLLLQDLSQLTTFCKLWLGVLSRMEKYAKAKVRGKRSEKLQEL
VPELLKNNLLVMKTKGVLVQRSALGGDSLWELTWLHVNNISPSLQSEVFPDQDSNRVLGQ
GEKGGLTSSEANSVSSTEKVASDNAGTGG
Download sequence
Identical sequences Cucsa.165100.1|PACid:16965961

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]