SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Cucsa.191610.1|PACid:16967907 from Cucumis sativus v122

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Cucsa.191610.1|PACid:16967907
Domain Number 1 Region: 42-250
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 6.45e-22
Family IMD domain 0.086
Further Details:      
 
Domain Number 2 Region: 310-376
Classification Level Classification E-value
Superfamily SH3-domain 1.84e-16
Family SH3-domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Cucsa.191610.1|PACid:16967907
Sequence length 382
Sequence
MEAIRKQASKFREQVAKQQQALMIKLGHFGTEPLLADEAEIQCHQQLHNLYNSTRTAKHF
QKNIVRGIEGFISLSTKQMAIVRRLADDCSKYGANNQNSCPALATAVLNFSMSHSSIEDK
RESLLGILGDQVCDPLRAQITGAPLEDARHLTHRYDKLRQEVEIQAAEVLRRRAKSRDSS
ISAESATRLENAEARLTELKSTMMALGKEATTAMQSVEAQQQQVTYERLRTMVDAERSYH
QHALTNLEMLNYELIQLAQSDGSLSTVALATDTNTVPTIRNGEENDQPSEYKKTTSKKSD
ARGPLDENKDYIIAKVIHPFDAQAEGELSLSIDDYVVLRQVWPNGWSEGECKGKTGWFPS
AYVEKQENISATSRSLSDSKSP
Download sequence
Identical sequences Cucsa.191610.1|PACid:16967907

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]