SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Cucsa.212610.1|PACid:16969367 from Cucumis sativus v122

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Cucsa.212610.1|PACid:16969367
Domain Number 1 Region: 46-255
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 3.66e-24
Family BAR domain 0.05
Further Details:      
 
Domain Number 2 Region: 276-342
Classification Level Classification E-value
Superfamily SH3-domain 5.64e-17
Family SH3-domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Cucsa.212610.1|PACid:16969367
Sequence length 348
Sequence
MDALRKQASKLKVQVAKQQQAVIKQFGGSGYESSDVMVIDEVEMQRHQQLEKFYRSTRAG
RDFQKDIVKAGEAFIAIGYRHIETGNKLSEDCCNYGANNINENILAKASSIYGDARKHVE
KEQEDLIKLFSSQILDPLRAMITGPPLEDARHLAQRYSRMRQEAETLAGEISRRRARVRE
FSNPENVAKLHASEAKMQELKANMAVLGKEASAALAAVDAQQQRLTLQRLVAMVEGEKTY
HLRVAAILGEVEAEMVTEKQRKESAPPVISSENHSGKSSFFLAEAVHPFNAASEKELSLS
VGDYVVVRKVSPSGWSEGECKGKGGWFPSSYVEKRQRIPTMNTVSESF
Download sequence
Identical sequences A0A0A0LUI7
Cucsa.212610.1|PACid:16969367 XP_011657485.1.97903

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]