SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Cucsa.242740.2|PACid:16971210 from Cucumis sativus v122

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Cucsa.242740.2|PACid:16971210
Domain Number 1 Region: 88-169
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.36e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0019
Further Details:      
 
Domain Number 2 Region: 192-222
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000000222
Family CCCH zinc finger 0.0016
Further Details:      
 
Domain Number 3 Region: 29-59
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000000288
Family CCCH zinc finger 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Cucsa.242740.2|PACid:16971210
Sequence length 226
Sequence
MMNLPPAPPAPRNMGAPPPPMSNGSATQAVKSRMCNKYNSAEGCKFGDKCHFAHAEWELG
KPSAPSHDDPRSMGHIPNRLASRMDAGPPGLAASFGASSTAKISVDASLAGAIIGKGGIN
SKQICRRTGAKLSIRDHESDPNLRNIELEGSFDQIKEASAMVQELIVTVSMAGPPKSATG
ATGGTAGPAGNNFKTKLCDNFAKGSCTFGERCHFAHGAAELRKSGV
Download sequence
Identical sequences Cucsa.242740.2|PACid:16971210

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]