SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Cucsa.257310.4|PACid:16972692 from Cucumis sativus v122

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Cucsa.257310.4|PACid:16972692
Domain Number 1 Region: 493-682
Classification Level Classification E-value
Superfamily Sec7 domain 4.45e-71
Family Sec7 domain 0.00000329
Further Details:      
 
Domain Number 2 Region: 828-1306
Classification Level Classification E-value
Superfamily ARM repeat 6.58e-23
Family PBS lyase HEAT-like repeat 0.083
Further Details:      
 
Weak hits

Sequence:  Cucsa.257310.4|PACid:16972692
Domain Number - Region: 70-106,135-152,257-419
Classification Level Classification E-value
Superfamily ARM repeat 0.00704
Family Armadillo repeat 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Cucsa.257310.4|PACid:16972692
Sequence length 1692
Sequence
MLWRQEVSGSSESYSGISRCYEGGQSESTSYTHRDKSTGSFSWRYQKLIAYDHLEGDPGL
EGGKNVSLFTDILNMICGCIDNSSPDSTILQVLKVLLTAVASAKFRVHGEPLLGVIRVCY
NIALNSKSPINQATSKAMLTQMISIIFRRMETDQVSLSTSSGTKDSSSAEVSSVVDEETT
VNEENDKETTLGDALNSVKDTSIASVEELQNLAGGADIKGLEAVLDKAVHIEDGKKMSRG
IDLESVNIIQRDALLVFRTLCKMGMKEDTDEVTTKTRILSLELLQGLLEGVSQTFTKDFH
FIDSVKAYLSYALLRASVSQPPVIFQYATGIFSVLLLRFRESLKGEIGIFFPLIVLRSLD
GTDFPVNQKTSVLKMLEKICREPQILVDIFVNYDCDLEAPNLFERMVTTLSKLSQGTQNA
DPNLAALSQATSIKGSSLQCLVNVLKSLVDWEKSRLHSEKEGLVHSSEEESSGNENLEVK
SREDVTGNFEKAKAHKSTVEAAISEFNRKPVKGVEYLISNKLVENTPSSVALFLRNTPSL
DKTMIGDYLGQHEEFPVAVMHAYVDSMKFSGMKFDAAIREFLKGFRLPGEAQKIDRIMEK
FAERYCADNPGLFKNADTAYVLAYAVIMLNTDAHNPMVWPKMSKSDFTRMNVMNDPEDCA
PTELLEEIYDSIVKEEIKMKDDLLDKAKSRRLEVEEKGGLVSILNLALPRRKSSTEAQSE
SEAIIKQTQVIFRNQGAKRGVFYTSQRIELVRPMVEAVGWPLLATFSVTMEEGDNKPRVV
LCMEGFRAGIHITHVLGMDTMRYAFLTSLVRFTFLHAPKEMRSKNVEALRTLLALCDLET
ESLQDTWNAVLECVSRLEFITSTPSIAATVMYGSNQISRDAVVQSLRELAGKPADQVFVN
SVKLPSDSVVEFFTALCGVSAEELKQTPARVFSLQKLVEISYYNMARIRMVWARIWSVLS
NHFISAGSHHDEKIAMYAIDSLRQLGMKYLERAELANFTFQNDILKPFVVLMRNSQSESI
RSLIVDCIVQMIKSKVGNIKSGWRSVFMIFTASADDESESIVESAFENVEQVILEHFDQV
VGDCFMDCVNCLIRFANNKSSHRISLKAIALLRICEDRLAEGLIPGGALKPIHDNESAEP
AFDMTEHYWFPMLAGLSDLTSDPRPEVRSCALEVLFDLLNERGSKFSMSFWESIFHRVLF
PIFDHLRHAGKESVNSSGDEWLRETSIHSLQLLCNLFNTFYKEVCFMLPPLLSLLLDCAK
QPEQSVVSLALGALVHLIEVGGHQFSEDDWDTLLKSIRDASYTTQPLELLNALGFENPSH
DELNIVDDGSLKWSSQQEAKNHHIDVNEHGKVSPVPSPRVAEIITRSPIAESGLQITTDE
SAEGIPSPSTRATRAAEAANLQRSQTIGQRIMGNMMDNIFVRSLTSKSKGRASDASVPSS
PIRLPPDTVDPEVKDDEESPLLGIVRGKCITQLLLLGVIDGIQKKYWVKLSAPQKIAIMD
ILLSLLEFSATYNSYNNLRQRMNHIPDERPPLNLLRQELAGTSIYLDILLKATSGFNTIE
AEQEKIADSLEVDSESPKDDLTSIQDSSAVSNVDGIAENRLVSFCEQALREVSDLQSSAV
ETTHMDVHRVLELRSPVIVKVIKGMCFMNSQIFRRHLREFYPLLTKLVCCDQIDIRGALG
DLFKIQLKALLP
Download sequence
Identical sequences Cucsa.257310.4|PACid:16972692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]