SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Cucsa.263980.1|PACid:16973254 from Cucumis sativus v122

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Cucsa.263980.1|PACid:16973254
Domain Number 1 Region: 167-248
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.94e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0015
Further Details:      
 
Domain Number 2 Region: 270-301
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000000837
Family CCCH zinc finger 0.0014
Further Details:      
 
Domain Number 3 Region: 99-131
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000000458
Family CCCH zinc finger 0.0022
Further Details:      
 
Domain Number 4 Region: 33-59
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000051
Family CCCH zinc finger 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Cucsa.263980.1|PACid:16973254
Sequence length 305
Sequence
MDMRKRGRPEAAFNSNGSFKKHKQELESLSTVGSKSKPCTKFFSTAGCPFGESCHFLHYV
PGGYNVVAQMMNLAPVGAQPSRNIAAPPSVTNGGPSAPSQVKTRMCNKYNTAEGCKFGDK
CNFAHGEWELGRPNPPSHDNPRAMGGGGGGGGGVHMVGRMGGRMDLPPPGPAASFGASAT
AKISIDASLAGAIIGKGGINSKQICRQTGAKLSIRDHESDPNLRNIELEGTFEQINEASA
MVRELIITVSMAGPGKASGGMGGGPAPTGSNYKTKLCDNFAKGSCTFGERCHFAHGAAEL
RKSGV
Download sequence
Identical sequences A0A0A0KZ79
XP_004146386.1.97903 Cucsa.263980.1|PACid:16973254

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]