SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Cucsa.263980.2|PACid:16973255 from Cucumis sativus v122

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Cucsa.263980.2|PACid:16973255
Domain Number 1 Region: 98-179
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.34e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0015
Further Details:      
 
Domain Number 2 Region: 201-232
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000000563
Family CCCH zinc finger 0.0014
Further Details:      
 
Domain Number 3 Region: 30-62
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000000314
Family CCCH zinc finger 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Cucsa.263980.2|PACid:16973255
Sequence length 236
Sequence
MMNLAPVGAQPSRNIAAPPSVTNGGPSAPSQVKTRMCNKYNTAEGCKFGDKCNFAHGEWE
LGRPNPPSHDNPRAMGGGGGGGGGVHMVGRMGGRMDLPPPGPAASFGASATAKISIDASL
AGAIIGKGGINSKQICRQTGAKLSIRDHESDPNLRNIELEGTFEQINEASAMVRELIITV
SMAGPGKASGGMGGGPAPTGSNYKTKLCDNFAKGSCTFGERCHFAHGAAELRKSGV
Download sequence
Identical sequences Cucsa.263980.2|PACid:16973255

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]