SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Cucsa.312850.8|PACid:16976923 from Cucumis sativus v122

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Cucsa.312850.8|PACid:16976923
Domain Number - Region: 88-144
Classification Level Classification E-value
Superfamily WWE domain 0.000759
Family WWE domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Cucsa.312850.8|PACid:16976923
Sequence length 384
Sequence
MNMETELTKVLHNGQKIVVGLKRKRANQGTSHAGAGYKAFLSKLSSSRNRHAKSRRLDDC
EVSCGPNSRRSLLRTYKNFIRSGLPQRFLYYEDGDWVDYPQIIVKLIREQFQIKNAAIEV
EFNGRHLLLDALYMIQVELKTAIQQHIAWIDDNDQCFFPEFYSGDSMMHQYHPYELEDAS
AAALSDHTGMREINLHLEIGLTEANISQSEEYVEESNRDTKKSNIKAKTCDIVGDWEGSE
TRSQKPVAGTQEAVGEIKEIDCYSTPQNEVIHSIVNSDDVKNMFLMSMESIKNIEILEVK
RWSSPLMQDRLDLFHKQIETTMKNRGNANVQYGWLALDKDILSGRMPYGGVGHSGLKPTS
LYGVRLSPSSCANLRYAFHLSSVK
Download sequence
Identical sequences Cucsa.312850.4|PACid:16976919 Cucsa.312850.5|PACid:16976920 Cucsa.312850.6|PACid:16976921 Cucsa.312850.7|PACid:16976922 Cucsa.312850.8|PACid:16976923

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]