SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Cucsa.350980.1|PACid:16979936 from Cucumis sativus v122

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Cucsa.350980.1|PACid:16979936
Domain Number 1 Region: 166-266
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.96e-26
Family B3 DNA binding domain 0.00015
Further Details:      
 
Domain Number 2 Region: 44-101
Classification Level Classification E-value
Superfamily DNA-binding domain 0.0000000000000085
Family GCC-box binding domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Cucsa.350980.1|PACid:16979936
Sequence length 339
Sequence
MKQEFSSMISKAKTNAVGETLDSSCITCPLPINGCSRQGRSLTSKFKGVVPQQNGHWGAQ
IYANHQRIWLGTFKSENEAAMAYDSAAIRIRSGDCHRNFPWTKVTIEEPNFQKLYTTETL
LNMIKDGSYRTKFSEYLRDRSESTQTSASPSTEKAHNNGGTSIKQLFQKELTPSDVGKLN
RLVIPKKYAVKYFPRISASTTENVEHVDDDRDLQLLFFDKMMRQWKFRYCYWKSSQSYVF
TRGWNRFVKEKQLKANDTIAFYLCEAAKSSDSKTTFCVVDVKNRDNSGGLVENETTCSEL
QLNLRHGEVEESVSPKHIDDELKDEREVKGFKLFGVHIK
Download sequence
Identical sequences A0A0A0LTJ1
Cucsa.350980.1|PACid:16979936 XP_004146691.1.97903 XP_011655965.1.97903 XP_011655970.1.97903

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]