SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Aspwe1|158118|estExt_Genewise1Plus.C_5_t30437 from Aspergillus wentii v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aspwe1|158118|estExt_Genewise1Plus.C_5_t30437
Domain Number 1 Region: 10-129
Classification Level Classification E-value
Superfamily TPR-like 4.24e-18
Family Tetratricopeptide repeat (TPR) 0.0041
Further Details:      
 
Domain Number 2 Region: 335-521
Classification Level Classification E-value
Superfamily RNI-like 1.49e-17
Family 28-residue LRR 0.053
Further Details:      
 
Domain Number 3 Region: 137-186
Classification Level Classification E-value
Superfamily F-box domain 0.000000000262
Family F-box domain 0.0037
Further Details:      
 
Domain Number 4 Region: 223-386
Classification Level Classification E-value
Superfamily RNI-like 0.0000022
Family Cyclin A/CDK2-associated p19, Skp2 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Aspwe1|158118|estExt_Genewise1Plus.C_5_t30437
Sequence length 560
Sequence
MVSSGLSRGEAAALQQHGQRLYQQGNFKAAVEAFTEALKVKDVDAVGVLDVRAATYTKLS
QYDQALRDARHMVKKDKHDERGYLRCAKALLLDGKPSKALEVYAYGLKTLPSNHPRRKLV
QQLHDKLQDKMTEKCLDPFTVLPLEMAVMVLQHFDFKQIVAILRVSRKWEQFLTSMRNLW
MHVDLSGGRGKMNWTSVRAYIRRSKGLLTHATIKNLATPSVQKSLELLSRCPKLEYLEVW
CPFNHNAFYDLFKGSRKLKTLVVSAHITMPQEHITKLLTGLPLLERVEFHSTKASSPPSV
NWPMKLPNLKVVTLGSQEQMPSAHFTPALDIPGLLHPSDPHSLPNLEELKLDWDPPVLQH
YPLKMDPVGCSRLRRLNLSGVRFDGNFGLPSSIESILIRRGTGVGEFPFSIDRPIELPNL
KTLVLSDISWVTIGTLQVFFVELEAPIRILHIDSCFNIRGTQLEMLTGSSNFNALVELNV
SHISALDDRLIARLTSKMSGLKVLNLSYTAITGCTVKMLADARSSEENIAKVDRIFAKGC
EELSSDAVSYARAKGIDIFT
Download sequence
Identical sequences A0A1L9RHQ0
jgi|Aspwe1|158118|estExt_Genewise1Plus.C_5_t30437

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]