SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Coc_C169_1|35003|fgenesh1_pm.2_#_13 from Coccomyxa subellipsoidea sp. C-169 v2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Coc_C169_1|35003|fgenesh1_pm.2_#_13
Domain Number - Region: 170-217
Classification Level Classification E-value
Superfamily HMG-box 0.00017
Family HMG-box 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Coc_C169_1|35003|fgenesh1_pm.2_#_13
Sequence length 226
Sequence
MPKKVGLNSKAEEAKAKKEETKKGKAVAEAKQKEDQEWRDAGEGSKTKAQAKKDEQEKKR
QEAAAKKAEAKKLAEEEEAQLATSAKKTPSKQTGSKVTSHQLRTQKEIEKQAAAEQAKKR
EAEAKRMVTEDDYAQRVEVENPNREEDAVEARSVEAALSALTVGEATPEDRHPERRARAA
FAAYSERMIAELKEEKPGLKQSQYKDMVWKLWQKAPENPFLRPPTT
Download sequence
Identical sequences I0Z6K2
XP_005650815.1.71052 jgi|Chlvu1|70885|fgeneshCV_pg.C_scaffold_2000022 jgi|Coc_C169_1|35003|fgenesh1_pm.2_#_13

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]