SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Coc_C169_1|40465|fgenesh1_pg.4_#_114 from Coccomyxa subellipsoidea sp. C-169 v2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Coc_C169_1|40465|fgenesh1_pg.4_#_114
Domain Number 1 Region: 98-175
Classification Level Classification E-value
Superfamily Histone-fold 7.45e-17
Family TBP-associated factors, TAFs 0.055
Further Details:      
 
Domain Number 2 Region: 3-66
Classification Level Classification E-value
Superfamily HMG-box 0.00000000000812
Family HMG-box 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Coc_C169_1|40465|fgenesh1_pg.4_#_114
Sequence length 253
Sequence
MAAKRAPTAFFIFSEEQREATRAECQAQAEPRVKVSVGAVAKAIGEKWRALTDEEKASYK
EKVAERAKALASAAADSAPAAGEQGEGEDHVGEEQERDHHADAQQNTNPFGFPLSLIKRI
MCLDPDVTRISGDGLKAVAKAAELMVEILGSRAAKEALSHKRKTIKLGDVERAVRMDRRL
VEIGLKEVLAEDMFREAGGKGPLKEAGNRGNVGRDEVMEGDAPQAANEAKAAGSKKRAKE
DDKVRHITDFFAR
Download sequence
Identical sequences I0Z3B4
XP_005649677.1.71052 jgi|Coc_C169_1|40465|fgenesh1_pg.4_#_114 jgi|Chlvu1|72021|fgeneshCV_pg.C_scaffold_4000123

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]