SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Coc_C169_1|53302|estExt_fgenesh1_pm.C_60225 from Coccomyxa subellipsoidea sp. C-169 v2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Coc_C169_1|53302|estExt_fgenesh1_pm.C_60225
Domain Number 1 Region: 47-124
Classification Level Classification E-value
Superfamily HMG-box 0.00000000393
Family HMG-box 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Coc_C169_1|53302|estExt_fgenesh1_pm.C_60225
Sequence length 222
Sequence
MAGNDAGRTTAQLLQFVAAELQGAFSHIGRAMATYSETGALPPSMFGAPAATKTRKRRDK
GHKRKPSAFNNYVKEKMAEIRASDNDDEDHATAIGTSIFSQAVDEWKKLSDEEKKIYAEK
YKAEEGEEEGAEDLEGDEEMEGDEEGHDEGENDGEEEEPEQEPAPQEPPKVEPPQAAQPV
SAKKEKKRKGPKADEPKAQAAPEQPAADEPKSDKKKKKKKDK
Download sequence
Identical sequences I0Z140
jgi|Chlvu1|82361|estExt_fgeneshCV_pg.C_60007 jgi|Coc_C169_1|53302|estExt_fgenesh1_pm.C_60225 XP_005648903.1.71052

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]