SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Coc_C169_1|53934|estExt_fgenesh1_pm.C_110129 from Coccomyxa subellipsoidea sp. C-169 v2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Coc_C169_1|53934|estExt_fgenesh1_pm.C_110129
Domain Number 1 Region: 53-126
Classification Level Classification E-value
Superfamily HMG-box 0.000000000209
Family HMG-box 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Coc_C169_1|53934|estExt_fgenesh1_pm.C_110129
Sequence length 236
Sequence
MADPAGAATAEVMVYVANELQGVFAHIGKALTEYSATGELPDSVFDVEPAAAAPTKRKRQ
KKDKERVKRKPSAFNHYVKEQIAVLRARPQTDEEHNNNSVFAEAVANWKKLPDGDKKAYT
EKFKANEAAREAAAAAAIADDDDDDEEEAVEEEDEDEEEEEPVKEPTPPPPPAPKKDKKR
KDKEGAEKKSEKKAKKDKAAATPMPPIPAPAAAPAPEADAPKKKKKKNKDKEKTKA
Download sequence
Identical sequences I0YUE6
jgi|Coc_C169_1|53934|estExt_fgenesh1_pm.C_110129 XP_005646559.1.71052

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]