SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Coc_C169_1|54136|estExt_fgenesh1_pm.C_130068 from Coccomyxa subellipsoidea sp. C-169 v2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Coc_C169_1|54136|estExt_fgenesh1_pm.C_130068
Domain Number 1 Region: 205-449
Classification Level Classification E-value
Superfamily PH domain-like 5.29e-68
Family SSRP1-like 0.00000723
Further Details:      
 
Domain Number 2 Region: 554-637
Classification Level Classification E-value
Superfamily HMG-box 2.49e-25
Family HMG-box 0.0000934
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Coc_C169_1|54136|estExt_fgenesh1_pm.C_130068
Sequence length 659
Sequence
MAESTGSHQYGNIILAHRSGTSTGNLKVSSSGLTWKKAGAGKTVEIQQGDIEGFVWSKTS
RGCQLAVKKSSGPMVQFLGFIDKDLTALRGVASVMNKEIEEQALSISGRNWGGATVEEGT
LVFRVGNKPAFRIPLRDVGQVQLGREEVTLEFPVDDTAGGDNEDALTDMVFYVPREATGF
VEDGEDQAAKVMYDQVLEHTDAGVATEDAVVTFDSLAVLIPRGRFDVELYPSFMKLLGQA
QDFRIQYDSILRLFVLPKTNTPHTLVVVSLDPPIRKGQTHYYHILVQFPSDEERQIELEL
SDEALAAKNEKCGGKLQKTLEGPAYDVFAKALRGLSGCKLTKPGTFRTADEAGFAVRCSY
KADDGYLYPLERAFFYIHKPPTLLVHDEIESIEFMRQGGGVLAASAKTFDLNIRMKTDNK
PEYLFRGIQKSEWQNLFSFIQAKRLRIENLREAELGPAGGGTALDLGDDIDTGLAQMEAH
GDLDDDSEEDADFDAGADSGAGEDDDDSGMSDDEDEETETKKKVAKAPKAKAEPKPKAEP
KKRKPAPAKKDDKKKKAKKDPNAPKKALSAFMFFSSAKRDEVKKENPDISFGEVGKALGD
KWKNISATEKAKYDEMAKKDKVRYAKAKEAYESKKKDEEEPKEEEDEDDEADDDEEDED
Download sequence
Identical sequences I0YRW5
jgi|Chlvu1|38618|estExt_Genewise1.C_130158 jgi|Coc_C169_1|54136|estExt_fgenesh1_pm.C_130068 XP_005645678.1.71052

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]