SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Coc_C169_1|57105|Genemark1.6134_g from Coccomyxa subellipsoidea sp. C-169 v2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Coc_C169_1|57105|Genemark1.6134_g
Domain Number 1 Region: 877-954
Classification Level Classification E-value
Superfamily RING/U-box 4.06e-24
Family U-box 0.00025
Further Details:      
 
Weak hits

Sequence:  jgi|Coc_C169_1|57105|Genemark1.6134_g
Domain Number - Region: 694-723
Classification Level Classification E-value
Superfamily HMG-box 0.0329
Family HMG-box 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Coc_C169_1|57105|Genemark1.6134_g
Sequence length 964
Sequence
MALQELAEEGGLPQVQLRLDRDNLERVLMARLMEEPAEAQWPLHYLLACYGRASDEFRAS
ASIKDAAAVQRVQESLLYSKQLVVSYSGLLLTMDMFPQPAVAQQRGALQLLDSLDRREGA
GPPTATPMPAGFLEDFAQRFEQEGLETIIEPIATEVSRRLVGMSPLGDYGAPLAMLQGLT
AIRPIARAYQKLPRWRPAVANGRQLQTESLLGPPFSLGVMPDVLSQPQPSVHQQCYAGLS
KQNPMEVNRIHHMLRAIMKTIHDTLYAISMNFLKSQDTREGMLSWFALALECNAERAKLQ
TNPRLAANHSFFVSLVTVLLRLCDPFLEPLSGKAWGKIDAGYVMRSKRIDYKDDTKLAVD
AEEQRAVQERLSSGDAASTPSYHFICECFFLTAKGLHLGLIKMIQDLYNLARTQQGLERD
LRHMDSMVQGMLEQNNPMVDHYQRQITMVKARIEQMGDMYIGYTAAISSDDLLKNSVLFY
RLVAAWMLRMASPATATTGQPELPLPSPAPLEFRMLPEYFVEDMVELLLYVSRFKPMVLE
GLPMEELLLFFVTFMGSPDFIHNPYLRSRMVEVLTTWMPQEEDGGASWKSRRSTQVAASV
LLLIDSHPLVLSNMVRSVLRLYVDIEHTSRNNAFYEKYNLRYSMGELLLHLWNIPAHREA
WRRVAQQEGGYGQLYQHFAHFLETDAIYLLNDAMEILPKVKETEIMMEDEERWKALPEEE
RQEQEQTLNQNTNQLRSDLLMAGRNLSIIRSSTTEVTAPWLLREMAPRIASTLNYFLLHL
AGSGRRKLKIKDPQRYSWQPKEVLAQIAAIYVHLSRADDNAVFAREIANDERSYNSSMFA
EASQVLRQFMLLSEGEIRELESLAARVVSAEAEKVAEEELLQDPPEEFVDALMDTLMEDP
VTLPTSKQVIDRSTISRHLLSDSHDPFNRMPLKEEDLIPNTELKARIQAWKAEMHEQARR
KMQS
Download sequence
Identical sequences I0YS24
jgi|Coc_C169_1|57105|Genemark1.6134_g XP_005645737.1.71052

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]