SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Coc_C169_1|57721|Genemark1.6750_g from Coccomyxa subellipsoidea sp. C-169 v2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Coc_C169_1|57721|Genemark1.6750_g
Domain Number 1 Region: 150-219
Classification Level Classification E-value
Superfamily HMG-box 2.49e-19
Family HMG-box 0.00034
Further Details:      
 
Domain Number 2 Region: 233-280
Classification Level Classification E-value
Superfamily HMG-box 0.000000000602
Family HMG-box 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Coc_C169_1|57721|Genemark1.6750_g
Sequence length 482
Sequence
MAELTDSQLMAELEEFEDAQAPDQLQTEVNETAKAEPEKQKVDPDSENMTPAANAASAGA
STHAAKLTVTKKSTTSPAPPADASTPKPSKKIQARVTPDDGDDADQASAVADKDATGKEQ
AGKGDGGKANGDKKKKSATPARSKAAGQQKKDADGSNTKVKRARSAYIFFGAEKRAAVKA
ENPTLSFGELTKKLGEMWKGISDAEKAPYEAMASEDKNRAGTERAEAKAEAKLFCDRHRQ
QIKDENADAGFGEITRKLAAAWKEITEEDKANYNKQHEAHPAETIVAETYHAKYLVKRKG
LDFSACGLVDARAAKRQRMLVPDDGDKTESSACHVTVAMMDEWDAFNRSFRCAVHAHSDS
GELDLGDAPSHPFSAVDIFNLLLLHLGIMREPDFPLSKAVKNKDVMIKVPMLEISKAVQR
VAAVERRAAQEAVAAAAAEREQRTKAEEALAAQQQETLQLRALLKEHSIAFEKGGQAARA
EE
Download sequence
Identical sequences I0YQA7
jgi|Coc_C169_1|57721|Genemark1.6750_g XP_005645120.1.71052

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]