SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Coc_C169_1|64298|estExt_Genemark1.C_10524 from Coccomyxa subellipsoidea sp. C-169 v2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Coc_C169_1|64298|estExt_Genemark1.C_10524
Domain Number 1 Region: 176-233
Classification Level Classification E-value
Superfamily HMG-box 0.000000000131
Family HMG-box 0.0028
Further Details:      
 
Domain Number 2 Region: 49-104
Classification Level Classification E-value
Superfamily HMG-box 0.000000000157
Family HMG-box 0.0049
Further Details:      
 
Domain Number 3 Region: 117-169
Classification Level Classification E-value
Superfamily HMG-box 0.0000000799
Family HMG-box 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Coc_C169_1|64298|estExt_Genemark1.C_10524
Sequence length 233
Sequence
MRGAPILLHRQASLPSIGVDGQRFFAASTKGRGTAKIKINAKAEATDEEPKKKGPRNAYQ
LFQKQSGPAILAKLGPTSLPERSRILAGAWKKLSDAEKATYAAQIVVGSSKPSSSLPRNT
YQLFVRQSSTEILAKHPEVKTIADRSRVLAAEWKRVPAEEKDRLAAELKKIAPARAKRQK
APTINNFALYVKENFHRVSKEQPKPSAADVMRELGSAWKTLSDSQKAGYSTKA
Download sequence
Identical sequences I0ZAB2
jgi|Coc_C169_1|64298|estExt_Genemark1.C_10524 XP_005652125.1.71052

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]