SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Coc_C169_1|67498|estExt_Genemark1.C_160092 from Coccomyxa subellipsoidea sp. C-169 v2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Coc_C169_1|67498|estExt_Genemark1.C_160092
Domain Number 1 Region: 182-258
Classification Level Classification E-value
Superfamily HMG-box 0.00000000000511
Family HMG-box 0.0022
Further Details:      
 
Domain Number 2 Region: 60-152
Classification Level Classification E-value
Superfamily HMG-box 0.0000000301
Family HMG-box 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Coc_C169_1|67498|estExt_Genemark1.C_160092
Sequence length 440
Sequence
MAARKPCSTGNFFGKSFPRAIGKLGDENKLVKTDDSPQLPNAPLLLWAGKADWNAGGAAP
KRMGKQPKAPLSPQDAYALYLQSLVSLPSAGKDFAETAEVSEDDLTVLKHDAALEGRKSW
GELSDKERKIFEDIAKEDTKRFQEEAVHYELRNPGWFAAWLQRQSVAPDGSRAAAAGGAA
GRPRPPLTAWMAFVEATLARLQETHPEAAAGIKRVELMRLAMKEAAPVYKSLTAEEKAQY
IKIAEEDKERYEKELAALPAEKKAKLSRKSSKKAKKTRGAAARAKKAVQENAEEQQAEER
QEEEVDTTGMTALQAWAAKQRVARRAATRKSAAPTRRPRKAAQRKAAAEEGTLEEDAPAA
EVEAELATLPDEAYIRTCATGDSDVSSDDEDDDDDVDISDDDDTDSAHGEPSVIADTQAD
EPMTQARNPNHAQPSKPIKS
Download sequence
Identical sequences I0YP13
jgi|Coc_C169_1|67498|estExt_Genemark1.C_160092 XP_005644676.1.71052 jgi|Chlvu1|84024|estExt_fgeneshCV_pg.C_160153

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]