SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Coc_C169_1|44434|fgenesh1_pg.18_#_36 from Coccomyxa subellipsoidea sp. C-169 v2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Coc_C169_1|44434|fgenesh1_pg.18_#_36
Domain Number 1 Region: 46-245
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.37e-21
Family Protein kinases, catalytic subunit 0.02
Further Details:      
 
Domain Number 2 Region: 613-669
Classification Level Classification E-value
Superfamily HMG-box 0.000000000209
Family HMG-box 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Coc_C169_1|44434|fgenesh1_pg.18_#_36
Sequence length 670
Sequence
MGSCACAGQLWALILLLLQASCVDNLQSLIDEGGAYLAEDAAVTAVIVTRQDEHFVVKRA
KSSETCENEAIILEHLAEQGAMGVPRCLGTSTFQRAKENEMHVIVLTYLGKQLPLDELKK
PEVRKQLADVLTEVHCCGVVNGDLKPSHIRVDDKGRVSIADWDLGAFRTKTGGTKVHEWV
KKGFQKDIYLKQLPHEHFWGVFEGTPTWAAPSTHLGYGPSVAGDFGSFGLICAAAISGKA
PWSEPLVKRRLNQQIDHAVLSVLLTLGLPAVIQAKVHVSPSGCDGGIVWADFWAHQRALA
VHAQSGVTEEQAAVAFAQYICGMGTSQVGAAHVAKVKRSYYGLHGQQIKGTAEETASGSS
DLGIDEAVGEEADLLLKKELSLALDIDIPEKAQDHKFKLQEEMALGALRRSDDKGDITVA
PDIFFPVKGISRVSIEDMLMGGDLNFEPVSLGARVQVDTGALKASEHPGEIELTQLIGEV
VVTKNPLSVLNKIGQLEVALYAAGAKADPAQRHPLDAFVRSESERAKLLFARKETSLAFN
TVAGDMARLEDKVDALVSIVQGLAQDFQDMRGTTTGAQSSPPAPAPATAPSAPSPVPSAT
PSALPSGSPSHRSGKKLRKPRRRSAYDIFRQQRGPAILDEHGPAPFPERAKILGRAWKAL
SDAEKRRYEG
Download sequence
Identical sequences I0YME7
jgi|Coc_C169_1|44434|fgenesh1_pg.18_#_36 jgi|Chlvu1|76412|fgeneshCV_pg.C_scaffold_18000199 XP_005644110.1.71052

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]