SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Coc_C169_1|47526|estExt_fgenesh1_pg.C_80144 from Coccomyxa subellipsoidea sp. C-169 v2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Coc_C169_1|47526|estExt_fgenesh1_pg.C_80144
Domain Number 1 Region: 328-371
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000111
Family Ovomucoid domain III-like 0.0047
Further Details:      
 
Domain Number 2 Region: 386-417
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000036
Family Ovomucoid domain III-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Coc_C169_1|47526|estExt_fgenesh1_pg.C_80144
Sequence length 726
Sequence
MKLSTILLVAAFAALVSTGDASSRQLLQGGLTSLFGTPTPTPTPSPAAGGSSPSPAGGSS
PSGGSSPSGGSSPSPAGGSSPSGSSPSSPAGGSSPSGSSPSSPAGGSSPSGGSSPSGGSS
PAATPFATPAATPAATQAAAANRQNTFAAAGTSASPSPSGTSASPSPSGQASPSPSNAFS
ASPSPSGTPAASPSPNQSAQRVAQAPTNSNAAAASILPVNQGSNAQAPTTGNTAQAPAAG
ARIAAVPPTTAQAPTTTAQAPQQANKPAAEAPTSGAQAPTSGAQAPTSGAQAPTSGAQAP
TSGAQAPKAAAPTAQPPKAATPGQAPSPAPLPPCNCAGVAESLVCGFDDKTYTSSCAAGC
ANVGVKSQGACPAVGPAPGVQCADSTEVCGGDGVTYSNTCTPKSKGVAIINNGPCKPVTA
QQASNNYYNVCVINNNNNNNGGGNNNNNNNNFCPGSSGTVNNNNNNNNNGGGGGANNNNN
NNNNGAGGAANNNNNNNNNGAGGAANNNNNNNNGAGGAANNNNNNNNNGGGAANNNNNNN
NSNGGSGVANNNNNNNNNNGGSVGGGGTINNNANNNPGAVAAPVLVSQPAQPVSPVNPFT
PAAPPATPTPSGCGGSILPQSTLNDLVVFCNATQAQLSGDYEVTYKVEIFGQENPQNSQV
TENAINCCLRCAFTGNCNIWDWCNASGGCGSGVAGGQCSLFSTKTLPNVVQSGASQPFLG
GYLARP
Download sequence
Identical sequences I0YXQ0
jgi|Coc_C169_1|47526|estExt_fgenesh1_pg.C_80144 XP_005647713.1.71052

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]