SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Coc_C169_1|60796|Genemark1.1607_g from Coccomyxa subellipsoidea sp. C-169 v2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Coc_C169_1|60796|Genemark1.1607_g
Domain Number 1 Region: 193-402,447-475
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 3.85e-52
Family Tyrosyl-DNA phosphodiesterase TDP1 0.0000462
Further Details:      
 
Domain Number 2 Region: 8-216
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 4.55e-42
Family Tyrosyl-DNA phosphodiesterase TDP1 0.00067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Coc_C169_1|60796|Genemark1.1607_g
Sequence length 502
Sequence
MIPPVASLLRVRGLPEQFSRGALGTQLKDLLSGGPMRWLLISNFMIDMRWFVSAAPSVLD
ADRVTVVHGEKSNPTSVSWMQQIAAGRPWVIHQARCPLQYGVHHSKAFLVQFDRGLRVVV
HTANLIHQDCNCKTQGLWYQDFPRKDERSPQDNASRLFETTLSDYIAALRLPAREAQHAQ
QVIAQHDFSSARAHLIPSVPGYHQGAAKQKYGHMLVRSLLARQRFDPVFRRSPIVAQFSS
LGSITGAWLSEFRESLAAGDCWDSNPSGSAGRLGPAADFRVVWPTVEEVKNSVEGWFAGC
SIPGTHANVLKTDKGLSTPILQPFWCRFDGAPATAGRQHAMPHIKSYLRHSGQRLAYIVL
TSHNLSKAAWGVLQKNNTQLHIMHYELGVLLLPSLEESYRRHRHFGFSCTAPASHKPAAA
AQPSRVEFWAADGAAAGSSEALSTGAEKLEILLPYQLPPVRYGPQDQPWMTGVEFPGLDS
QGLTIHQSFDRNSHYGHVEPDD
Download sequence
Identical sequences I0Z562
XP_005650325.1.71052 jgi|Coc_C169_1|60796|Genemark1.1607_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]