SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for clementine0.9_017763m|PACid:19271890 from Citrus clementina v165

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  clementine0.9_017763m|PACid:19271890
Domain Number 1 Region: 57-282
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 1.57e-81
Family Inorganic pyrophosphatase 0.000000715
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) clementine0.9_017763m|PACid:19271890
Sequence length 286
Sequence
MAAAKAISQTTSCLLSKTPFALKHKSHITNLCFGTKGVAFPSKRLFSCRAIYNPQVQITE
EGQPETLDYRVFFVNNSGKKVSPWHDIPLQLGDGVFNFVVEIPKESSAKMEVATDELYTP
IKQDIKKGKLRYYPYNINWNYGLFPQTWEDPSFANSEVEGAFGDNDPVDVVEIGERRRKI
GEILRVKPLSALAMIDEGELDWKIVAISLDDPKAALVNDVDDVEKHFPGTLTAIRDWFRD
YKIPDGKPANKFGLGNKAADKVITETNESWAKLVKRSIEAGELSLV
Download sequence
Identical sequences clementine0.9_017763m|PACid:19271890

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]