SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for clementine0.9_018227m|PACid:19271891 from Citrus clementina v165

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  clementine0.9_018227m|PACid:19271891
Domain Number 1 Region: 57-228
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 1.57e-63
Family Inorganic pyrophosphatase 0.00000429
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) clementine0.9_018227m|PACid:19271891
Sequence length 276
Sequence
MAAAKAISQTTSCLLSKTPFALKHKSHITNLCFGTKGVAFPSKRLFSCRAIYNPQVQITE
EGQPETLDYRVFFVNNSGKKVSPWHDIPLQLGDGVFNFVVEIPKESSAKMEVATDELYTP
IKQDIKKGKLRYYPYNINWNYGLFPQTWEDPSFANSEVEGAFGDNDPVDVVEIGERRRKI
GEILRVKPLSALAMIDEGELDWKIVAISLDDPKAALVNDVDDVEKHFPVSNILKESQKKV
IMKMIIIAANIKYISYRKNAKLGGLNWNVGSCWSSE
Download sequence
Identical sequences A0A067FXL9 V4U9F7
XP_006422674.1.91645 orange1.1g023844m|PACid:18099680 clementine0.9_018227m|PACid:19271891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]