SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for clementine0.9_019747m|PACid:19284483 from Citrus clementina v165

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  clementine0.9_019747m|PACid:19284483
Domain Number 1 Region: 62-242
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 9.29e-67
Family Inorganic pyrophosphatase 0.00000475
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) clementine0.9_019747m|PACid:19284483
Sequence length 248
Sequence
MKLRMSLEAYVVLQSFFLSFLLFIIALFLYDLYEMSNHLGTAGSNNSGGPPVALNERILS
SMSHRSVAAHPWHDLEIGPGAPAVCNCVVEIGKGGKVKYELDKASGLIKVDRVLYSSVVY
PHNYGFIPRTICEDSDPMDVLVLMQEPVLPGSFLRCRAIGLMPMIDQGEKDDKIIAVCAD
DPEFRHYKDIKELPPHRLAEIRRFFEDYKKNENKKVDVEDFLPAEAAIEAIKYSMDLYAS
YIVESLRQ
Download sequence
Identical sequences V4UHQ3
XP_006425644.1.91645 clementine0.9_019747m|PACid:19284483

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]