SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for clementine0.9_020384m|PACid:19276525 from Citrus clementina v165

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  clementine0.9_020384m|PACid:19276525
Domain Number 1 Region: 80-236
Classification Level Classification E-value
Superfamily IpsF-like 7.46e-58
Family IpsF-like 0.00000961
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) clementine0.9_020384m|PACid:19276525
Sequence length 237
Sequence
MVLTMAAQSYTTTPLHRKITNKPLCPPLLSLKPRSLTAKHLRTTQSTSLPRISVSAAATS
SIEVKESSASIQPSKSKSLPFRVGHGFDLHRLEPGYPLIIGGINVPHERGCEAHSDGDVL
LHCVVDAILGALGLPDIGQIFPDSDPKWKGAPSSVFIKEAVRLMDEAGYEIGNLDATLIL
QRPKLSPYKETIRTNLSELLGADPTVVNLKAKTHEKVDSLGENRSIAAHTVILLMKK
Download sequence
Identical sequences A0A067GLX5 V4TS53
clementine0.9_020384m|PACid:19276525 orange1.1g026508m|PACid:18118689 XP_006439471.1.91645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]