SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for clementine0.9_022164m|PACid:19260883 from Citrus clementina v165

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  clementine0.9_022164m|PACid:19260883
Domain Number 1 Region: 33-176
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 8.11e-61
Family Inorganic pyrophosphatase 0.00000958
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) clementine0.9_022164m|PACid:19260883
Sequence length 203
Sequence
MMAPPIETSSKTPVSQPPAHPPLNERILSSMSRRSVAAHPWHDLEIGPGAPKIFNCVIEI
GKGSKVKYELDKKSGLIMVDRVLYSSVVYPHNYGFIPRTLCEDNDPLDVLIIMQEPVLPG
CFLRAKAIGLMPMIDQGEKDDKIIAVCADDPEYRHYNDIKELPPHRLAEIRRFFEDCILS
TIYNGSICFICELPFLSLMQVEL
Download sequence
Identical sequences A0A067D400 V4SNL4
XP_006429017.1.91645 clementine0.9_022164m|PACid:19260883 orange1.1g028820m|PACid:18103040

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]