SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for clementine0.9_023572m|PACid:19252684 from Citrus clementina v165

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  clementine0.9_023572m|PACid:19252684
Domain Number 1 Region: 8-105
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 8.44e-22
Family B3 DNA binding domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) clementine0.9_023572m|PACid:19252684
Sequence length 173
Sequence
MAESITAEPFRFFKIIEETLQDKKLRIPVDFVKKFGDELCDVATLRVPNGCVWKVGLTRE
GRKIWFNDGWHDFVKNHSILKDYFLVFEYAKNSTFDVLIFDKTACEIEYTCAEPENEKQN
DGKKIKPRKVAYEDEYKFVAVLEEMGICISGAYKFLSVEERQRIICASRLVSA
Download sequence
Identical sequences V4S7E1
clementine0.9_023572m|PACid:19252684 XP_006423112.1.91645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]