SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for clementine0.9_023765m|PACid:19276526 from Citrus clementina v165

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  clementine0.9_023765m|PACid:19276526
Domain Number 1 Region: 80-165
Classification Level Classification E-value
Superfamily IpsF-like 4.06e-33
Family IpsF-like 0.0000871
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) clementine0.9_023765m|PACid:19276526
Sequence length 169
Sequence
MVLTMAAQSYTTTPLHRKITNKPLCPPLLSLKPRSLTAKHLRTTQSTSLPRISVSAAATS
SIEVKESSASIQPSKSKSLPFRVGHGFDLHRLEPGYPLIIGGINVPHERGCEAHSDGDVL
LHCVVDAILGALGLPDIGQIFPDSDPKWKGAPSSVFIKEAVRFFFNLYF
Download sequence
Identical sequences V4TM50
clementine0.9_023765m|PACid:19276526 XP_006439470.1.91645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]