SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for clementine0.9_024034m|PACid:19260884 from Citrus clementina v165

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  clementine0.9_024034m|PACid:19260884
Domain Number 1 Region: 3-158
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 4.06e-62
Family Inorganic pyrophosphatase 0.0000112
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) clementine0.9_024034m|PACid:19260884
Sequence length 163
Sequence
MQVIEIGKGSKVKYELDKKSGLIMVDRVLYSSVVYPHNYGFIPRTLCEDNDPLDVLIIMQ
EPVLPGCFLRAKAIGLMPMIDQGEKDDKIIAVCADDPEYRHYNDIKELPPHRLAEIRRFF
EDYKKNENKEVAVNDFLPASDAYNSVQQSMNLYADYIVESLRR
Download sequence
Identical sequences V4S4E0
clementine0.9_024034m|PACid:19260884 XP_006429018.1.91645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]