SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for clementine0.9_025390m|PACid:19259263 from Citrus clementina v165

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  clementine0.9_025390m|PACid:19259263
Domain Number 1 Region: 18-119
Classification Level Classification E-value
Superfamily Thioredoxin-like 8.02e-26
Family Thioltransferase 0.00089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) clementine0.9_025390m|PACid:19259263
Sequence length 129
Sequence
MGANVSSLENPHGFIHAKTPLVMELQSKHQWRSQYEASKQSDRLVVIYYTAAWCGPCKFI
DPYVKDFAAMYTDVQFIKIDVDWLPEAAKAFDLIDVLPTFVLVKRGKEIDRVVGAKKDEL
QMKTEKRRN
Download sequence
Identical sequences A0A2H5N8X9 V4TJL4
clementine0.9_025390m|PACid:19259263 XP_006438555.1.91645 XP_006483262.1.29302

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]