SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for clementine0.9_032819m|PACid:19263638 from Citrus clementina v165

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  clementine0.9_032819m|PACid:19263638
Domain Number 1 Region: 496-686
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 6.41e-69
Family Inorganic pyrophosphatase 0.00000483
Further Details:      
 
Domain Number 2 Region: 283-455
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.63e-29
Family Protein kinases, catalytic subunit 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) clementine0.9_032819m|PACid:19263638
Sequence length 691
Sequence
MSNSLLCNETCGNFHSIPFPFHLNNSCASVSSSAFRLSCLNSTTLYLKLDTLSYRVLEFF
SDGVLVDFPGVTSCRQYNDLNAFGFAKTDYFGLSADNVIGLYDCEDSSLCKAGCSPACCY
PLSDRSTWHFGDGFSVFSKFGCRGFSSWVVSRGSNTGKRGVKLEWAVPGNISSNQICDSN
ANIVNATAVEAGVRCLCQDGFVGDGFANGTGCIKSCFKDGQEVYGSDCFTKRKNEKQGVI
VAGVLAPAFIIASLLALLCLLKRPVKAQAFDQYDQAHFNSTISFRKACRTRLFAYHELEE
ATRGFKDSQKLADSKNGSIYAGVIGDGSHVAVQKVQCENETDLIQVLSQVELLSAIMHRN
LARLLGCCIDSGFINPIVVYEYPANGTLEEHLLKSSEQKACLDWYKRLIIAAETASVLAF
LQFEISPPIFHHDLKSCYIFLDEDYCVKVAGFGIPSTSLGVGSNSCNNQQAMCMSEEAAH
GDGSEAVEAPQGSVPRLNERILSSMSRRSVAAHPWHDLEIGPGAPTIFNVVVEISKGSKV
KYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLILMQEPVLPGCFLRAR
AIGLMPMIDQGEKDDKIIAVCADDPEYKHYTDIKELPPHRLTEIRRFFEDYKKNENKKVA
VNEFLPTSTAVEAIQYSMDLYAEYIMLSLRR
Download sequence
Identical sequences clementine0.9_032819m|PACid:19263638

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]