SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for clementine0.9_033972m|PACid:19251164 from Citrus clementina v165

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  clementine0.9_033972m|PACid:19251164
Domain Number 1 Region: 36-216
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 8.77e-69
Family Inorganic pyrophosphatase 0.0000041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) clementine0.9_033972m|PACid:19251164
Sequence length 221
Sequence
MGDEPETEPPIPPVQTAAEGNRPVPKLNERILSTLSRRSVAAHPWHDLEIGPGAPQVVNI
VVEITKGSKVKYELDKKTGLIKVDRVLYSSVVYPHNYGFIPRTLCEDNDPLDVMILMQEP
VIPGSYLRARAIGLMPMIDQGEKDDKIIAVCADDPEYKHYTDIKQLPPHRLMEIRRFFED
YKKNENKEVAVNEFLPPQTAFDAIQYSMDLYAEYILQSLRR
Download sequence
Identical sequences V4TXJ5
XP_006443220.1.91645 XP_006478998.1.29302 clementine0.9_033972m|PACid:19251164

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]