SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for clementine0.9_000277m|PACid:19265051 from Citrus clementina v165

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  clementine0.9_000277m|PACid:19265051
Domain Number 1 Region: 829-1119
Classification Level Classification E-value
Superfamily BEACH domain 7.32e-125
Family BEACH domain 0.0000000101
Further Details:      
 
Domain Number 2 Region: 1241-1319,1352-1418,1451-1498
Classification Level Classification E-value
Superfamily WD40 repeat-like 8.49e-26
Family WD40-repeat 0.0035
Further Details:      
 
Domain Number 3 Region: 713-818
Classification Level Classification E-value
Superfamily PH domain-like 4.18e-24
Family PreBEACH PH-like domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) clementine0.9_000277m|PACid:19265051
Sequence length 1527
Sequence
MLVEDHLRLQSKLSCASRKKDASPSPLSLVSPLNNHSSLSASIGAESLDSLGDRRSDSSG
LPLDVLASMADANGQISAAVMERLTAAAAAEPYESVSCAFVSYGSCAMDLAEGWKYRSRL
WYGVGLPSKSSEIGGGGSGWDSWNSSLEKDANGNWIELPLVKKSVSMLQALLLDESGLGG
GLGIGGGSGTGMGGMAALYQLLDSDQPFLCMLRMALLSMREEDNGEDSMFMRNVNMEDEM
SEGLHRHASNIGVLSPVLNMPISDSKRQRVLVASCVLYSEVWHSVSRDRKTLRKQYLEAI
LPPFVAVLRRWRPLLAGIHELATADGLNPLILDDRALAADSLPLEAAIAMISAPWAAAFA
SPPAAMALAMIAAGAAGGDAPAPVATSQLRRDTSLLERKQTRLYTFSSFQKTSEVTNKSS
PLPKDKASAKAAALAAARDLERNAKIGSGRGLSAVAMATSAQRRNASDTERVERWNISEA
MGVAWMECLQPVDTKSVYGKDFNALSYKFIAVLVASFALARNMQRSEIDRRSQVDLISRH
RWCTGMRAWRKLIHCLIEMKCLFGPFEDHLSDPRRIFWKLDFMESSSRMRRCLRRNYMGS
DHFGAAANYEDQIERKPGQENVINPSNAPIVAAEAISMEAVNEDDEQTENDNLDDRVYNL
DNVGEDQTTVSEKIEQTLQASADSSDIPPARDQDLVSSSTAVLPGYVPSELDERIVFELP
SSMVRPLRVIRGTFQVTTRRINFIVDNTESPEEGTSELRNQEKDRSWLMSSLHQIYSRRY
LLRRSALELFMVDRSNFFFDFGSTEGRRNAYRAIVQARPPHLNDIYLATQRPEQLLKRTQ
LMERWARWEISNFEYLMQLNTLAGRSYNDITQYPVFPWILSDYSSENLDLANPSSYRDLS
KPVGALNPDQLKKFQERYSSFDDPVIPKFHYGSHYSSAGTVLYYLFRVEPFTTLSIQLQG
GKFDHADRMFSDIAATWNGVLEDMSDVKELVPELFYLPEILTNENSIDFGTTQLGGKLDS
VGLPPWAENPVDFIHKHRMALESDYVSAHLHEWVDLIFGYKQRGKEAISANNVFFYITYE
GTVDIDKISDPVQQRAAQDQIAYFGQTPSQLLTVPHMKKMPLGDVIHLQTIFRNPKEVKP
YAVPVPERCNLPAAAIHASSDTVVIVDMNAPAAHIARHNWQPNTPDGQGTPFLFQHGKAS
ASPASGTFLRMFKGPGGSGADEWHFPRALAFASSGIRSSAVVSITHDKEIITGGHVDGSI
KLLTSDGAKTLETASGHCAPVTCLALSSDSNFLVTGSQDTTILLWRIHRAFTSRTGTIEP
SSGMGTPGNSIGSSTPANASADKSRRRRIEGPIHVLRGHHREILCCCVSSDLGVVVSCSD
SSDLLLHSIRRGRLIRRLVGVDAHAVSLSSVLNGSYDNIQGLNSKQSGTEDFDLASDQSV
DNNRFDVPSPSICFLDLHTLKVFHVLKLGEGQDITALALNKDNTNLLVSTADKQLIVFTD
PALSLKVVDQMLKLGWEGDGLSPLIKS
Download sequence
Identical sequences clementine0.9_000277m|PACid:19265051

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]