SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for clementine0.9_008557m|PACid:19286509 from Citrus clementina v165

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  clementine0.9_008557m|PACid:19286509
Domain Number 1 Region: 203-482
Classification Level Classification E-value
Superfamily Mitochondrial carrier 6.28e-80
Family Mitochondrial carrier 0.0000445
Further Details:      
 
Domain Number 2 Region: 26-200
Classification Level Classification E-value
Superfamily EF-hand 1.08e-35
Family Calmodulin-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) clementine0.9_008557m|PACid:19286509
Sequence length 490
Sequence
MATQQSNGSNPVKKAGTSVTMEHVLLALGESKEEREQRIRALFNFFDVNNSGYLDYAKIE
AGLSSLNIPSEYKYARDLLNVCDSNQDGRVEYQEFRRYMDDKELELYRIFQAIDVEHNGG
ILPEELYHALVKAGIEIDDEELATFVERVDKDNNGVITFEEWRDFLLLYPHEATMENIYH
YLERVCLVDIGEQAAIPEGISKHVHANRYLISGGVAGATSRTATAPLDRLKVVLQVQTTR
AHIMPAIRDIWRDGGISGFFRGNGLNVIKVAPESAIKFYTYERLKKLIAKVEGDEEKTNI
GASGRLFAGGLAGAVAQTAIYPMDLVKTRLQTYVCEGGKVPKIGAMSRDILVQEGPRAFY
RGLVPSLLGIIPYAGIDLAAYESFKEMSKKYILHDSEPGPLVQLGCGTFSGALGATCVYP
LQVVRTRMQAQRMNTESAYTGMSDVFKRTFKSEGLRGFYKGLFPNLLKVVPSASITYMVY
EAMKKSLELE
Download sequence
Identical sequences V4U7S6
XP_006446900.1.91645 clementine0.9_008557m|PACid:19286509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]