SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for clementine0.9_012370m|PACid:19286543 from Citrus clementina v165

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  clementine0.9_012370m|PACid:19286543
Domain Number 1 Region: 105-384
Classification Level Classification E-value
Superfamily Mitochondrial carrier 1.96e-79
Family Mitochondrial carrier 0.0000368
Further Details:      
 
Domain Number 2 Region: 4-102
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000000196
Family Calmodulin-like 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) clementine0.9_012370m|PACid:19286543
Sequence length 393
Sequence
MDDKELELYRIFQAIDVEHNGGILPEELYHALVKAGIEIDDEELATFVERVDKDNNGVIT
FEEWGDFLLLYPHEATMENIYHYLERVCLVDIGEQAAIPEGISKHVHANRYLIAGGVAGA
TSRTATAPLDRLKVVLQVQTTRAHIMPAIRDIWRDGGILGFFRGNGLNVLKVAPESAIKF
YTYERLKKLIAKVEGDEEKTNIGASGRLFAGGLAGAMAQTAIYPMDLVKTRLQTYVCEGG
KVPKIGAMSRDILVQEGPRAFYRGLVPSLLGIIPYAGIDLAAYESFKEMSKKYILHDSEP
GPLVQLGCGTFSGALGATCVYPLQVVRTRMQAQCMNTESAYTGMSDVFKRTFKSEGLRGF
YKGLFSNLLKVVPSASITYMVYEAMKKSLELEY
Download sequence
Identical sequences V4W2K3
clementine0.9_012370m|PACid:19286543 XP_006446894.1.91645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]