SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for clementine0.9_014037m|PACid:19286510 from Citrus clementina v165

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  clementine0.9_014037m|PACid:19286510
Domain Number 1 Region: 71-350
Classification Level Classification E-value
Superfamily Mitochondrial carrier 2.48e-80
Family Mitochondrial carrier 0.0000445
Further Details:      
 
Domain Number 2 Region: 1-47
Classification Level Classification E-value
Superfamily EF-hand 0.000000189
Family Polcalcin 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) clementine0.9_014037m|PACid:19286510
Sequence length 358
Sequence
MGIEIDDEELATFVERVDKDNNGVITFEEWRDFLLLYPHEATMENIYHYLERVCLVDIGE
QAAIPEGISKHVHANRYLISGGVAGATSRTATAPLDRLKVVLQVQTTRAHIMPAIRDIWR
DGGISGFFRGNGLNVIKVAPESAIKFYTYERLKKLIAKVEGDEEKTNIGASGRLFAGGLA
GAVAQTAIYPMDLVKTRLQTYVCEGGKVPKIGAMSRDILVQEGPRAFYRGLVPSLLGIIP
YAGIDLAAYESFKEMSKKYILHDSEPGPLVQLGCGTFSGALGATCVYPLQVVRTRMQAQR
MNTESAYTGMSDVFKRTFKSEGLRGFYKGLFPNLLKVVPSASITYMVYEAMKKSLELE
Download sequence
Identical sequences V4W2L2
clementine0.9_014037m|PACid:19286510 XP_006446899.1.91645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]