SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for clementine0.9_015558m|PACid:19270574 from Citrus clementina v165

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  clementine0.9_015558m|PACid:19270574
Domain Number 1 Region: 189-326
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.12e-32
Family Thioltransferase 0.00034
Further Details:      
 
Domain Number 2 Region: 59-162
Classification Level Classification E-value
Superfamily TPR-like 2.11e-22
Family Tetratricopeptide repeat (TPR) 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) clementine0.9_015558m|PACid:19270574
Sequence length 328
Sequence
MSDSVKHFEAMKSNLSTEDDDDIVESDIELDNTDVMEPDNDPSQKMGDPSVEVTEEMRDA
ANMTKLKAVDLISEGKLEDAIGQLTEAIMLNPTSAILYAARAGVYVKLNKPNAAIRDAYV
ALETNPDSAKGYKIRGMARARLGQWEEAANDLHVASKLDYDEEIGMALKKVEPNARRIQE
HRRKYERLRKERELKNFERERQRKQAGADREALSGLRDGQVMGIHSASEFETKLNAATRA
LRLVILYFTATWCGPCRFISPLFTNLASKYTKVVFLKVDIDEARDVATRWNIGSVPTFFF
IKNGKEVDKVVGADKSALERKIAQHAGQ
Download sequence
Identical sequences D0ELH6
NP_001275870.1.29302 clementine0.9_015557m|PACid:19270573 clementine0.9_015558m|PACid:19270574

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]