SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for clementine0.9_017510m|PACid:19271889 from Citrus clementina v165

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  clementine0.9_017510m|PACid:19271889
Domain Number 1 Region: 57-287
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 1.01e-85
Family Inorganic pyrophosphatase 0.000000499
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) clementine0.9_017510m|PACid:19271889
Sequence length 291
Sequence
MAAAKAISQTTSCLLSKTPFALKHKSHITNLCFGTKGVAFPSKRLFSCRAIYNPQVQITE
EGQPETLDYRVFFVNNSGKKVSPWHDIPLQLGDGVFNFVVEIPKESSAKMEVATDELYTP
IKQDIKKGKLRYYPYNINWNYGLFPQTWEDPSFANSEVEGAFGDNDPVDVVEIGERRRKI
GEILRVKPLSALAMIDEGELDWKIVAISLDDPKAALVNDVDDVEKHFPGTLTAIRDWFRD
YKIPDGKPANKFGLGNKAADKDYALKVITETNESWAKLVKRSIEAGELSLV
Download sequence
Identical sequences A0A067FP73 V4RNJ0
XP_006422673.1.91645 clementine0.9_017510m|PACid:19271889 orange1.1g022875m|PACid:18099679

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]