SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for clementine0.9_030321m|PACid:19277322 from Citrus clementina v165

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  clementine0.9_030321m|PACid:19277322
Domain Number 1 Region: 276-360
Classification Level Classification E-value
Superfamily HMG-box 1.57e-23
Family HMG-box 0.00055
Further Details:      
 
Domain Number 2 Region: 158-238
Classification Level Classification E-value
Superfamily HMG-box 1.96e-21
Family HMG-box 0.00073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) clementine0.9_030321m|PACid:19277322
Sequence length 363
Sequence
MASSDVASMAVEPSKKPRSRRALKPKNSLANEAVVMAQTPSQSPIPNPPDAGLSKENHES
LSQPKKAAAKGKAKQATKKQDTSFDKDLQEMQEMLEKMKLEKEKTEELLKEKDEMLKMKE
EELELQGKEQEKLHMELKKLQKMKEFKPNMTLPIVQCLKDKEQDRKKKGCAERKRPSPPY
ILWCKDQWNEVKKENPEAEFKEITNILGAKWKNVSAEEKKPYEEKYQAEKEAYLQVMAKE
RRESEAMKLLEEEHKQKTAMELLEQYLQFKQEADKENKKPKKEKDPLKPKHPVTAYFLFS
SERRAALLADNKNVLEVAKITGEEWKNMTEEQKRPYEEIAKKNKEKYNEEMEAYKRRMKE
LLV
Download sequence
Identical sequences clementine0.9_030321m|PACid:19277322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]