SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000000259 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000000259
Domain Number 1 Region: 4-343
Classification Level Classification E-value
Superfamily Cysteine proteinases 3.39e-125
Family Calpain large subunit, catalytic domain (domain II) 0.000000000279
Further Details:      
 
Domain Number 2 Region: 351-503
Classification Level Classification E-value
Superfamily Calpain large subunit, middle domain (domain III) 1.96e-53
Family Calpain large subunit, middle domain (domain III) 0.000000652
Further Details:      
 
Domain Number 3 Region: 520-687
Classification Level Classification E-value
Superfamily EF-hand 1.14e-42
Family Penta-EF-hand proteins 0.00000973
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000000259   Gene: ENSGMOG00000000251   Transcript: ENSGMOT00000000266
Sequence length 688
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_4166:97334:117937:-1 gene:ENSGMOG00000000251 transcript:ENSGMOT00000000266 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGVASTLAKKRALAAGFGTNANAVKYLNQDFHSLRAQSAGALFCDHTFAAAPESLGFKD
LGRNSPKTRGVTWKRPTELVSSPEFIIGGATRTDICQGGLGDCWLLAAIASLTLNEDVMA
RVVPSDQDFGDQYAGIFHFQFWQYGEWVDVVIDDRLPVKDGELLFVHSAEGREFWSALLE
KAYAKVCGCYEALSGGSTTEGFEDFTGGIAENFDLKNAPPNMFQIVKKALEAGSLLGCSI
DITSASDSEAVTRQKLVKGHAYSLTGAVEVGYRGRQEKLIRVRNPWGQVEWTGAWSDGSS
EWNSVEGECPNANAEDGEFWMSFTEFMRHYSRIEICTLTPDTILDDSIKHWSVGKFDGTW
RKGSTAGGCRNNPYTFWTNPQFVIKLNEEDDDPEDGEEGCSVVLGLIQKNRRKMRKSGED
MHTIGFAIYEXXXXFHGQTQVHLDKNFFLTHAQKARSETFINLREVSTRFKLPPGEYLVV
PSTYEAHLNGDFCIRVFXXXXXXXXPCDDPVEAELEDEEVSDEDVDAGFRGLFTKLAGDD
MEISYVELRNILNKIVSKRTDIKTDGFCCETCRVMVNLLDESGNGKLGLGEFATLWKKVQ
KYLTIYKQNDGDNSGTMSTPEMRVALKSAGFTLNNAIYQMLVCRYAEPDMTMDFDNFVAC
LMRLEMMFRIFKKLDTEDSGTVQVTLDQ
Download sequence
Identical sequences ENSGMOP00000000259 ENSGMOP00000000259

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]