SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000000392 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000000392
Domain Number 1 Region: 2-119
Classification Level Classification E-value
Superfamily EF-hand 1.09e-31
Family Osteonectin 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000000392   Gene: ENSGMOG00000000399   Transcript: ENSGMOT00000000414
Sequence length 120
Comment pep:novel genescaffold:gadMor1:GeneScaffold_3455:2345:3076:1 gene:ENSGMOG00000000399 transcript:ENSGMOT00000000414 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VPGCPEGKKGEFITSLLDALTTDMVQAINSPAPSGGGRFVEPDPNHTLEERVVHWYFAQL
DNNGSQDINKKELKPLKRYLKKKAKPKKCARRFTDYCDLNRDKAISLAELKGCLGVSKES
Download sequence
Identical sequences ENSGMOP00000000392 ENSGMOP00000000392

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]