SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000000507 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000000507
Domain Number 1 Region: 46-364
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 6.54e-84
Family Formin homology 2 domain (FH2 domain) 0.0000157
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000000507   Gene: ENSGMOG00000000505   Transcript: ENSGMOT00000000535
Sequence length 924
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_4035:31084:41324:-1 gene:ENSGMOG00000000505 transcript:ENSGMOT00000000535 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QIDVSSVEELFGQREEGSGGAAWPTGASEQQAGVGRTRSFKESSKDEINILDAKRGMNVG
IFLKQFKKSNHSIVEDIRQGEGQIYGAELLKDLLKLLPDAEEIKKLRSFKGDPSKLTLVD
SFMFLLIQVPRFEVRIEAMVLCAEFSASCAVMSREIDVIRVATKELMNCEELHAILHLVL
QAGNIMNAGGYAGNAVGFKLSSLLSLADTKANKPGMNLLHFVALEAKKKDEMLLKFPEKL
QDVQSAARISVESIESEFTSLYVRTKTLEEKVQEDQELHLQLEPFLQSSGQTLQDLKRRR
LDLRKEGNALIDFFCEDKETFKLDEGFRIFQDFCIKFKKAVKDNQDRELKEEARHRRLRE
LEEKRYAWTGADQSAGGFGRSSSENDVEMLTKEGLLGFFQQRSQSPGSPMSRSASARRHR
HTVNSAADRELHGYLELFGEPGAPTDFSRFNSLPRAGRTHQRRTAPWILSDLDSSPELGR
DRQPTALSPSPETEPPYCNNNNYRSVSEGSALPSSCYMFRSPAQLPNPTITGHMNISVEK
HTLVQGPQTFDLASPNNNSNHTHFVQQGDFGTHEEGQRGSSPELGKAGITQSGDWLHKDI
EEEDNSSLSSTTCDTPLPLDSSLSNKKPMFNILDCTEADCSVALDYSEIDSLPILREGLD
LKTPNKKNGQDQATFSPNEKSASTSTNELSARKSTDASSITPSATTEDWDTDSCDTAEGK
KPGKVGNRKLPQAKSKVTKSVKGLGCLGVRTLTNSENQGMRKVVPLTRHNRSVSNKRAER
PSVQDGSEPRRPLRDQSTPARGRSEKTTRTPRHSSVPPDEAKAQRGTSLAGTLSRWARDN
TPKKSSLHKPSAKPLRNIPKAPPEEKMCRSTMRALAQAQAQVGASSEASSSQALGPKTAS
GVPRFARNTVASTSRKIKELVPTS
Download sequence
Identical sequences ENSGMOP00000000507 ENSGMOP00000000507

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]