SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000001023 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000001023
Domain Number 1 Region: 125-430
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 5.1e-80
Family Formin homology 2 domain (FH2 domain) 0.00000932
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000001023
Domain Number - Region: 4-52
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.00418
Family beta-sandwich domain of Sec23/24 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000001023   Gene: ENSGMOG00000000956   Transcript: ENSGMOT00000001060
Sequence length 436
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_4337:14115:19101:-1 gene:ENSGMOG00000000956 transcript:ENSGMOT00000001060 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VVAPPPPAPPSQPIPALTPACPPPPPPPPPPPPPPPPPTSSPPPPPPPPPLATPAPCTIQ
RRCMKKVNWVAIPGRCILGKMNVWTSGRSQTEDLVLDLRSMEELFSQGETQAPWKGRRTP
GDGHKGISILDAKKSMNIAIFLKTFKRPVPEMVEDIIHGNWLRFGTGKLGELCKLLPDTS
EVKKLCAFNGNVSHLAEADRFMVQLVRVPGYDERLKTMVLREEFFPQMEEMKTSVDVMTK
AANELLDCDDLHSVIRLVLKAGNYMNAGGHSGNAIGFRMNSLLQLSDTKANKPGMNLMHY
VAKQAEDIDAELLTFPSQLEHIAMASRICQGEVKADFEREVKKIEEVQLYASRQPSLLQQ
METFLLRARLKLSDLSSSLSELGKLSEAVAEFFCEDPAAFKLEDCCSVFSSFCQKFLTAI
QDNRLREALELRRKCK
Download sequence
Identical sequences ENSGMOP00000001023 ENSGMOP00000001023

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]