SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000001220 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000001220
Domain Number 1 Region: 269-442
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.65e-57
Family SPRY domain 0.0000648
Further Details:      
 
Domain Number 2 Region: 3-69
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000754
Family RING finger domain, C3HC4 0.018
Further Details:      
 
Domain Number 3 Region: 72-134
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000111
Family B-box zinc-binding domain 0.0011
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000001220
Domain Number - Region: 120-242
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.0732
Family Hemolysin E (HlyE, ClyA, SheA) 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000001220   Gene: ENSGMOG00000001171   Transcript: ENSGMOT00000001266
Sequence length 444
Comment pep:known genescaffold:gadMor1:GeneScaffold_2900:225934:227505:-1 gene:ENSGMOG00000001171 transcript:ENSGMOT00000001266 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SEENFSCPICLDVFSSPIFTPCGHNFCRTCITKFWDEQAQYAVKSCLVCLISYCQTHLEP
HQRVAGLKKHQLVEPLDHLEERMCKKHDRLLELFCRTEQVFVCQFCTEGDHRSHPVVPLK
EECEVKMAQLGNIESEVLQIIQERNRKINEIKDTIKLSKKDADREIADGLQVLNALMCCI
EKWQEDFNQTVQEKMKSTEKQAEDLIKELEQEIEDLTNRSSELKLLPQTKDHLNFLQAFI
PEPPPTRDWTTLEETLNTEMKKLREVVELKRVQQYEVVVTLDPDTAHPCLTLSDDGKQVN
YGGLVNQLPDNPKRFTICGVLSRQSFSSGRFYFEVQVKDTSVWYLGVARESINRKANIAL
TPKNGYWMILFHTCFYFDDPVVLLPLRAELQKVGVFVDCDEGLVSFYDVEAKVHIYSATG
CTFSEPLYPFLCNCHCAPLIISPV
Download sequence
Identical sequences ENSGMOP00000001220 ENSGMOP00000001220

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]