SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000001239 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000001239
Domain Number 1 Region: 61-290,333-382
Classification Level Classification E-value
Superfamily MFS general substrate transporter 1.02e-49
Family LacY-like proton/sugar symporter 0.026
Further Details:      
 
Domain Number 2 Region: 502-643
Classification Level Classification E-value
Superfamily MFS general substrate transporter 6.15e-17
Family Glycerol-3-phosphate transporter 0.037
Further Details:      
 
Domain Number 3 Region: 408-485
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.00000000183
Family Pentapeptide repeats 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000001239   Gene: ENSGMOG00000001189   Transcript: ENSGMOT00000001285
Sequence length 648
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_486:10032:54167:-1 gene:ENSGMOG00000001189 transcript:ENSGMOT00000001285 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DGYAYQGDYPAQEEDAASDATEGHDEEDQMYEGEYQGIPHPDEVKAAQRAARELEELSEQ
YEEIMEDCGHGRFQWTLFIVLGLALMADGVECFVVAFVLPSAEKDLCLSNAEKGMLGLLV
YVAMLAGALVWGGLSDKLGRRKVLIYVLTIDIVFSFLSCFAQGYGFFLFFRFCSGFGIGG
SIPIVYTYFAEFLQIEKRGEHLSWLCMFWMLGGLYASFTAWGIIPHYGWGFSMGTEFQFH
SWRVFVLVAALPAIISLVGLTFMPESPRFLLENAKHDEAWMILKRVHDTNWRAKGQPEKV
FTVTHIKAPKTAEDEFIEIQSATGTAVQRWAVRSATLQVLKNVASLLSAELRITTLFLAI
IWFCMAFSYYGLSVWFPDMIKHLQNEEYEARVKVFHGERVERFRFNFSLENQIHREGEYI
RDEFINIEIKSVTFEDSLFEDCYFKDIRSSNTVFRNCTIRSTEFINTDLWKDKFIDCKLE
NVSWHENKRGCHLDAAEENDVLIYLVSFLGSLAVLPGNIVSALFMEKVGRVKIIGGSMLV
SAGCTFLLFLSFSQAAIIAMQCLFCGVSAAAWNGIEVVTVELYPTSKRATAFGLLNAMCK
LAAILGSSIFASFVGITKVIPILLSFVALICGGLVALKLPDTREKILQ
Download sequence
Identical sequences ENSGMOP00000001239 ENSGMOP00000001239

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]